(data stored in ACNUC7421 zone)

EMBL: CP002157.PE297

CP002157.PE297       Location/Qualifiers
FT   CDS             338625..339920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00155"
FT                   /product="penicillin-binding protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00155"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99620"
FT                   /db_xref="GOA:A4AWV3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV3"
FT                   /protein_id="EAQ99620.1"
FT                   /translation="MKTTKRILKYLAITLFAIALWIVTVVSSTMNGWWRESITNESDIK
FT                   SFIHAVNDEVKNQFVGNFAMATINNGKVEAEIFHTAGTVVDRNTVFQVASLSKWVSAVG
FT                   VMKLVENGKLDLDVPVSTYLTRWQLPESKYNNDKVTVRRLLSHTAGLTDGLGYSGFESE
FT                   ESIQELEASLTNAADADKGVSGVVEVGVEPGEFKYSGGGFTLLQLLVEEVSGESFTSYM
FT                   KNTIFEPLNMNYSNYKWNEDSGYKLVEFYNDDGSEAKHYRYTSLAATSLYTSISDLELF
FT                   FQFFMKGKNNEPIGRNVLKPETLKSMREVHATSLGMDIWGLGTILYTKTDNGDFIIGHD
FT                   GKSTPPINTAVRLNPETGDGIIVLETGNSDLATKLASEWVFWKTKKVDVILFAMSEDKM
FT                   KSIIGRGVISIVILSILMGVIRYRKKYAKRTK"
     MKTTKRILKY LAITLFAIAL WIVTVVSSTM NGWWRESITN ESDIKSFIHA VNDEVKNQFV        60
     GNFAMATINN GKVEAEIFHT AGTVVDRNTV FQVASLSKWV SAVGVMKLVE NGKLDLDVPV       120
     STYLTRWQLP ESKYNNDKVT VRRLLSHTAG LTDGLGYSGF ESEESIQELE ASLTNAADAD       180
     KGVSGVVEVG VEPGEFKYSG GGFTLLQLLV EEVSGESFTS YMKNTIFEPL NMNYSNYKWN       240
     EDSGYKLVEF YNDDGSEAKH YRYTSLAATS LYTSISDLEL FFQFFMKGKN NEPIGRNVLK       300
     PETLKSMREV HATSLGMDIW GLGTILYTKT DNGDFIIGHD GKSTPPINTA VRLNPETGDG       360
     IIVLETGNSD LATKLASEWV FWKTKKVDVI LFAMSEDKMK SIIGRGVISI VILSILMGVI       420
     RYRKKYAKRT K                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page