(data stored in ACNUC7421 zone)

EMBL: CP002157.PE299

CP002157.PE299       Location/Qualifiers
FT   CDS             340369..340971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00165"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99622"
FT                   /db_xref="GOA:A4AWV5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWV5"
FT                   /protein_id="EAQ99622.1"
FT                   /translation="MNYTSDIVFTPAVKKFQEQFKSRNSYARMEQFGGWNSKVSSDLEG
FT                   FLKDMDSFYFGSANADGQPYIQHRGGKKGFLKVVDNETLAFADFSGNKQYISIGNLSEN
FT                   NKATIFLMHYVSQTRIKIWGTAYVDTDESLIASLRDENYNAKIERAIVFKVKAWDVNCK
FT                   QHIKQRFAADEIKKITEPLESKIKTLETTIDHLKSNN"
     MNYTSDIVFT PAVKKFQEQF KSRNSYARME QFGGWNSKVS SDLEGFLKDM DSFYFGSANA        60
     DGQPYIQHRG GKKGFLKVVD NETLAFADFS GNKQYISIGN LSENNKATIF LMHYVSQTRI       120
     KIWGTAYVDT DESLIASLRD ENYNAKIERA IVFKVKAWDV NCKQHIKQRF AADEIKKITE       180
     PLESKIKTLE TTIDHLKSNN                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page