(data stored in ACNUC7421 zone)

EMBL: CP002157.PE308

CP002157.PE308       Location/Qualifiers
FT   CDS             349258..349512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00210"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99631"
FT                   /db_xref="GOA:A4AWW4"
FT                   /db_xref="UniProtKB/TrEMBL:A4AWW4"
FT                   /protein_id="EAQ99631.1"
FT                   /translation="MPDVLISPLGVIVTTTEIFALYLSIRFKTEYCAKLSLFVVALCFG
FT                   NDILNGNERSIFDYSVFTVSASAFALSLMKEKYLELDNF"
     MPDVLISPLG VIVTTTEIFA LYLSIRFKTE YCAKLSLFVV ALCFGNDILN GNERSIFDYS        60
     VFTVSASAFA LSLMKEKYLE LDNF                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page