(data stored in ACNUC7421 zone)

EMBL: CP002157.PE311

CP002157.PE311       Location/Qualifiers
FT   CDS             complement(350988..351848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00240"
FT                   /product="predicted hydrolase or acyltransferase
FT                   (alpha/beta hydrolase superfamily) protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00240"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00048"
FT                   /db_xref="GOA:A4AV26"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV26"
FT                   /protein_id="EAR00048.1"
FT                   /translation="MEKFKIDEQLYPFKSNYIKINNEIKVHYVDEGEGPVILMLHGNPT
FT                   WSFLYRKMINELKDEYRVIAPDYPGFGLSPTPLKYDFLPSTHSQIIEEFINLLDLKEII
FT                   LVMQDWGGPIGLNIAINNPELVRGMVLGNTWAWPLKRFGQKMFSHIMGGYIGRWMAHSF
FT                   NGVWHVFMKKGFVKSPSNRELAMYKAPFENSENSKQTAIFPKELYNSKSFLAKIESSLN
FT                   ILKEKPVLFTWGKHDFAFQKPELSIFQSIFKNHEVKMLDASHFWQDEQGELASKYIKNW
FT                   ASKTN"
     MEKFKIDEQL YPFKSNYIKI NNEIKVHYVD EGEGPVILML HGNPTWSFLY RKMINELKDE        60
     YRVIAPDYPG FGLSPTPLKY DFLPSTHSQI IEEFINLLDL KEIILVMQDW GGPIGLNIAI       120
     NNPELVRGMV LGNTWAWPLK RFGQKMFSHI MGGYIGRWMA HSFNGVWHVF MKKGFVKSPS       180
     NRELAMYKAP FENSENSKQT AIFPKELYNS KSFLAKIESS LNILKEKPVL FTWGKHDFAF       240
     QKPELSIFQS IFKNHEVKML DASHFWQDEQ GELASKYIKN WASKTN                      286
//

If you have problems or comments...

PBIL Back to PBIL home page