(data stored in ACNUC7421 zone)

EMBL: CP002157.PE314

CP002157.PE314       Location/Qualifiers
FT   CDS             353445..354695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00255"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00051"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV29"
FT                   /protein_id="EAR00051.1"
FT                   /translation="MVIIHLKKYQMKTLKITLTILCFAFIHLNTNAQLAERIELTNNNQ
FT                   LLGLGTQYFLKSEILQEDRPIIISLPVGYKNNDANYPVLYLLDGLGNIKHVVGTVELLT
FT                   ESGTIPPIIIVAIESLDRSRDLTPSKAGKDVYGGTGDAGIPQSGGAPEFLQFLEKELIP
FT                   YVESNFRTHPYRLLEGHSFGGLFGTYTLMEKPGIFDAFIIQSPALWWNKEEMTEKAKEF
FT                   FQSNTNLDKSVYFGIGGGDGWGMRQELIRYVDVIKQNNPKNLHWMHQEIGDEGHDDARL
FT                   LLNYYGLKFVFSDLKASENSLKNYSDEVFLKSEQHLADKYGKNVRRPASDYFDIITKLL
FT                   NDQNDLGAITVLKRASEAYPNYAILSNNLGQLYEKTNQIDKAIEAYESAIIISKKLKLG
FT                   QEVGYQKEIDRMKNSQE"
     MVIIHLKKYQ MKTLKITLTI LCFAFIHLNT NAQLAERIEL TNNNQLLGLG TQYFLKSEIL        60
     QEDRPIIISL PVGYKNNDAN YPVLYLLDGL GNIKHVVGTV ELLTESGTIP PIIIVAIESL       120
     DRSRDLTPSK AGKDVYGGTG DAGIPQSGGA PEFLQFLEKE LIPYVESNFR THPYRLLEGH       180
     SFGGLFGTYT LMEKPGIFDA FIIQSPALWW NKEEMTEKAK EFFQSNTNLD KSVYFGIGGG       240
     DGWGMRQELI RYVDVIKQNN PKNLHWMHQE IGDEGHDDAR LLLNYYGLKF VFSDLKASEN       300
     SLKNYSDEVF LKSEQHLADK YGKNVRRPAS DYFDIITKLL NDQNDLGAIT VLKRASEAYP       360
     NYAILSNNLG QLYEKTNQID KAIEAYESAI IISKKLKLGQ EVGYQKEIDR MKNSQE           416
//

If you have problems or comments...

PBIL Back to PBIL home page