(data stored in ACNUC7421 zone)

EMBL: CP002157.PE315

CP002157.PE315       Location/Qualifiers
FT   CDS             354849..355271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00260"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00052"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV30"
FT                   /protein_id="EAR00052.1"
FT                   /translation="MIGNKIKGLGEIILRVNDMELMRKFYIETIGLELIHESQCYTFFK
FT                   VADGYAGHHQTIAIFAKNNRTAFDEILSTIDVKKSTLHHFALEIDKVDYDNILTFCNRQ
FT                   KIEHVTEVFEWVKWKSIFIKDPESNIIEFVCYDDNI"
     MIGNKIKGLG EIILRVNDME LMRKFYIETI GLELIHESQC YTFFKVADGY AGHHQTIAIF        60
     AKNNRTAFDE ILSTIDVKKS TLHHFALEID KVDYDNILTF CNRQKIEHVT EVFEWVKWKS       120
     IFIKDPESNI IEFVCYDDNI                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page