(data stored in ACNUC7421 zone)

EMBL: CP002157.PE319

CP002157.PE319       Location/Qualifiers
FT   CDS             357143..357676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00280"
FT                   /product="ribosomal-protein-serine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00280"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00056"
FT                   /db_xref="GOA:A4AV34"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV34"
FT                   /protein_id="EAR00056.1"
FT                   /translation="MNTDFRNYKIIEFDTKQCGPLYDLIDSNRERLETYFAGTVKNTKT
FT                   LEDTISYCKQIDMRVKNKSYYIYTITNKENNSLIGLIDVKNIDWNVPKAEIGYFIDFNH
FT                   QGKGIITNAVAILIEYLLKEYNFKKLLCRINSENIGSIKVALNNGFKLEGTIRNDYRTT
FT                   SNEIVDLNYYGRIF"
     MNTDFRNYKI IEFDTKQCGP LYDLIDSNRE RLETYFAGTV KNTKTLEDTI SYCKQIDMRV        60
     KNKSYYIYTI TNKENNSLIG LIDVKNIDWN VPKAEIGYFI DFNHQGKGII TNAVAILIEY       120
     LLKEYNFKKL LCRINSENIG SIKVALNNGF KLEGTIRNDY RTTSNEIVDL NYYGRIF          177
//

If you have problems or comments...

PBIL Back to PBIL home page