(data stored in ACNUC7421 zone)

EMBL: CP002157.PE322

CP002157.PE322       Location/Qualifiers
FT   CDS             358983..359384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00295"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00059"
FT                   /db_xref="GOA:A4AV37"
FT                   /db_xref="InterPro:IPR020509"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV37"
FT                   /protein_id="EAR00059.1"
FT                   /translation="MKTKRAILLGIAIWVIGILFYSLSFYTPILENAETQANLVLFIIV
FT                   MPLVWLGCSYYYKKDNKTHGYKVGQTMLLTAVALDALITVPFFVIPNGGNHYTFFTSLG
FT                   FWIIAFEFLAVAVLYWYTRVYPHKTPSKK"
     MKTKRAILLG IAIWVIGILF YSLSFYTPIL ENAETQANLV LFIIVMPLVW LGCSYYYKKD        60
     NKTHGYKVGQ TMLLTAVALD ALITVPFFVI PNGGNHYTFF TSLGFWIIAF EFLAVAVLYW       120
     YTRVYPHKTP SKK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page