(data stored in ACNUC7421 zone)

EMBL: CP002157.PE331

CP002157.PE331       Location/Qualifiers
FT   CDS             366786..368420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00340"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00068"
FT                   /db_xref="GOA:A4AV46"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV46"
FT                   /protein_id="EAR00068.1"
FT                   /translation="MKKYIISFSIVLYAFAVPFLELNNTHVFNPDWTPHVRIHEVWQLI
FT                   TNTGIGILCLWLVWFKNELKISALLSMLITGGFLLAYFIKDLYGGSMKYLDGSEKTLLG
FT                   INIGVLGFGIAFILLLATIKTKTPKNNGVNFFTVTLCFLFASSTFSQSVDQSQWIEDID
FT                   LYKSQLEQKHIDLYNKISKVEFENEIHEIKTDIQSKNDVAIIIDLMQLTHKIGDGHTAF
FT                   SLRGVETHLFPIEIYKVNGKWRVIKVTKEYEYLLGKILVGIDGKKFNRICKEVSKVAQY
FT                   IENKQSKIIRTGEYSMISELLHGLNITDSEFKARFTFLDDSTGEKNNILLRAISNKEYY
FT                   GNTEFRFFQTTIPQVQKPTDTKHDYLWFSPIKDAKGVYIKFESYPSFEEMEEFGESVLE
FT                   FINENDTENVVIDLRNNGGGDFFVGTFLAYYLNLADSIDWKSGVYVLTDKVTFSAATSN
FT                   ASQFRQMLNAKIVGEPTGSNPTGYQDMGQFTLPNSGIIVTHSKRLFKFQDKSTEGVQPD
FT                   VFIEYEWKSYSKGIDNMMQWIISDINN"
     MKKYIISFSI VLYAFAVPFL ELNNTHVFNP DWTPHVRIHE VWQLITNTGI GILCLWLVWF        60
     KNELKISALL SMLITGGFLL AYFIKDLYGG SMKYLDGSEK TLLGINIGVL GFGIAFILLL       120
     ATIKTKTPKN NGVNFFTVTL CFLFASSTFS QSVDQSQWIE DIDLYKSQLE QKHIDLYNKI       180
     SKVEFENEIH EIKTDIQSKN DVAIIIDLMQ LTHKIGDGHT AFSLRGVETH LFPIEIYKVN       240
     GKWRVIKVTK EYEYLLGKIL VGIDGKKFNR ICKEVSKVAQ YIENKQSKII RTGEYSMISE       300
     LLHGLNITDS EFKARFTFLD DSTGEKNNIL LRAISNKEYY GNTEFRFFQT TIPQVQKPTD       360
     TKHDYLWFSP IKDAKGVYIK FESYPSFEEM EEFGESVLEF INENDTENVV IDLRNNGGGD       420
     FFVGTFLAYY LNLADSIDWK SGVYVLTDKV TFSAATSNAS QFRQMLNAKI VGEPTGSNPT       480
     GYQDMGQFTL PNSGIIVTHS KRLFKFQDKS TEGVQPDVFI EYEWKSYSKG IDNMMQWIIS       540
     DINN                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page