(data stored in ACNUC7421 zone)

EMBL: CP002157.PE333

CP002157.PE333       Location/Qualifiers
FT   CDS             complement(368920..369618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00350"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00070"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV48"
FT                   /protein_id="EAR00070.1"
FT                   /translation="MLVKQLHVHKEENDFNEFYSKISSFAPNLKKFMSRSLMAAEAQSS
FT                   IDRGFYNAEGMLDEIYLEVFKDLSKFSDEEKLKTILFAKAVQKIEEKKILEQENPDYLS
FT                   TESLLKQELNRLDESFTTQADGDLILNTELDDISYKQTKERSSKVILDESLEQQLIKKL
FT                   DMQDELLPSFEHRALFGTLYSNIPLRSKSVLELYTFGNQSIHDVSEILEVPENVIEHIL
FT                   DKLKERFRLL"
     MLVKQLHVHK EENDFNEFYS KISSFAPNLK KFMSRSLMAA EAQSSIDRGF YNAEGMLDEI        60
     YLEVFKDLSK FSDEEKLKTI LFAKAVQKIE EKKILEQENP DYLSTESLLK QELNRLDESF       120
     TTQADGDLIL NTELDDISYK QTKERSSKVI LDESLEQQLI KKLDMQDELL PSFEHRALFG       180
     TLYSNIPLRS KSVLELYTFG NQSIHDVSEI LEVPENVIEH ILDKLKERFR LL               232
//

If you have problems or comments...

PBIL Back to PBIL home page