(data stored in ACNUC7421 zone)

EMBL: CP002157.PE335

CP002157.PE335       Location/Qualifiers
FT   CDS             complement(370398..371174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00360"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00072"
FT                   /db_xref="GOA:A4AV50"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV50"
FT                   /protein_id="EAR00072.1"
FT                   /translation="MNIGLVLSGGGVRGVAHIGAIKALEEHGIFPNHIAGASAGAIVGA
FT                   LYANGNTWEEILDFFKSVQIFKLNKFARNKPGFIDTEKLYDSFKSYLVDDNFSSLQMPL
FT                   AITTTNLLTGTLKVFDAGELIRPILASAAFPGVFTPVEIGGEHYIDGGTLNNFPVDLIK
FT                   TSCDTIVGVYVNPFEVLRINDLKYSFSILDRAYKIKTAHESIEKFEDCNLVISPKDLKK
FT                   YGTFSVKDIDAVFDLGYKAANEALTEDMVSVLLGDS"
     MNIGLVLSGG GVRGVAHIGA IKALEEHGIF PNHIAGASAG AIVGALYANG NTWEEILDFF        60
     KSVQIFKLNK FARNKPGFID TEKLYDSFKS YLVDDNFSSL QMPLAITTTN LLTGTLKVFD       120
     AGELIRPILA SAAFPGVFTP VEIGGEHYID GGTLNNFPVD LIKTSCDTIV GVYVNPFEVL       180
     RINDLKYSFS ILDRAYKIKT AHESIEKFED CNLVISPKDL KKYGTFSVKD IDAVFDLGYK       240
     AANEALTEDM VSVLLGDS                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page