(data stored in ACNUC7421 zone)

EMBL: CP002157.PE339

CP002157.PE339       Location/Qualifiers
FT   CDS             complement(372326..373513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00380"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00380"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00076"
FT                   /db_xref="GOA:A4AV54"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV54"
FT                   /protein_id="EAR00076.1"
FT                   /translation="MKVLILNSGSSSIKFQLIEMPEEKVICGGLVERIGSRDSVLVFNL
FT                   SGKKHKKKLPINDHKEGLIKISNVLLDVENGILKSTEEIEAVGHRVVHGGNAFSETTLV
FT                   NKEVKRIIKENFSLAPLHNPHNLLGIEIAEQIFSNSKQIAVFDTAFHQSIPTKVRKYAI
FT                   PNKFYEENGIQLYGFHGTSHKYVSERAADYLGREDAKLITIHLGNGCSISAVKNGKSVD
FT                   HSLGFAPSNGLIMGSRSGDIDHSIVFYLVNELGYSLDEVNNMLNKESGMLGLTGYSDLR
FT                   DIESEAERGNHACKLALEMNAYRIKKYIGAYAAAMNGLDALIFTAGIGENSELIRKMVC
FT                   NEMQFLEIEIDDLFNSRKSAHLREINTSDSIVKVLVIPTNEELEIAKQAFHLLEN"
     MKVLILNSGS SSIKFQLIEM PEEKVICGGL VERIGSRDSV LVFNLSGKKH KKKLPINDHK        60
     EGLIKISNVL LDVENGILKS TEEIEAVGHR VVHGGNAFSE TTLVNKEVKR IIKENFSLAP       120
     LHNPHNLLGI EIAEQIFSNS KQIAVFDTAF HQSIPTKVRK YAIPNKFYEE NGIQLYGFHG       180
     TSHKYVSERA ADYLGREDAK LITIHLGNGC SISAVKNGKS VDHSLGFAPS NGLIMGSRSG       240
     DIDHSIVFYL VNELGYSLDE VNNMLNKESG MLGLTGYSDL RDIESEAERG NHACKLALEM       300
     NAYRIKKYIG AYAAAMNGLD ALIFTAGIGE NSELIRKMVC NEMQFLEIEI DDLFNSRKSA       360
     HLREINTSDS IVKVLVIPTN EELEIAKQAF HLLEN                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page