(data stored in ACNUC7421 zone)

EMBL: CP002157.PE346

CP002157.PE346       Location/Qualifiers
FT   CDS             379623..380264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00415"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00083"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV61"
FT                   /protein_id="EAR00083.1"
FT                   /translation="MKNTITFLSLILIIPVLALAQTVNTVFDEVAPFSEGLAAVRIENQ
FT                   WGFINENAELVLDFRDDLVWNKDADTSVPGVLGIRYPEFKNGRCMIQILKEDSIPYYGF
FT                   IDQSGEIIIQPEYLNITQFDHENAIGIYVRKAFQGNNEIKLKVIDYIFTEVVVNISGEI
FT                   IWPIAEREHILTAKRRYETPELKAKLIAKDLLVYRTKDDKWETKKLNISL"
     MKNTITFLSL ILIIPVLALA QTVNTVFDEV APFSEGLAAV RIENQWGFIN ENAELVLDFR        60
     DDLVWNKDAD TSVPGVLGIR YPEFKNGRCM IQILKEDSIP YYGFIDQSGE IIIQPEYLNI       120
     TQFDHENAIG IYVRKAFQGN NEIKLKVIDY IFTEVVVNIS GEIIWPIAER EHILTAKRRY       180
     ETPELKAKLI AKDLLVYRTK DDKWETKKLN ISL                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page