(data stored in ACNUC7421 zone)

EMBL: CP002157.PE347

CP002157.PE347       Location/Qualifiers
FT   CDS             380275..381036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00420"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00084"
FT                   /db_xref="GOA:A4AV62"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV62"
FT                   /protein_id="EAR00084.1"
FT                   /translation="MNRLINKVAIITGGAGGIGFSTAKIFIQEGAKVMLVGRTESTLRK
FT                   ATSDLNSPHVRYCTADVSKTTDTKLYLQETLDQFGKIDILFANAGIEGPFSPIADYPEE
FT                   MFDSVIAINLKGVWLGCKYGIPRLNDGGSVIITSSVAGLKGFSGLGAYTTSKHGVIGIM
FT                   RVAALESAVRNVRVNTIHPGPVNTRMMRDIEKDISPDNAQKAKKGFEAGVPFGRYAEAE
FT                   EIADLVLFLASDESKYITGSTYVIDGGMVAS"
     MNRLINKVAI ITGGAGGIGF STAKIFIQEG AKVMLVGRTE STLRKATSDL NSPHVRYCTA        60
     DVSKTTDTKL YLQETLDQFG KIDILFANAG IEGPFSPIAD YPEEMFDSVI AINLKGVWLG       120
     CKYGIPRLND GGSVIITSSV AGLKGFSGLG AYTTSKHGVI GIMRVAALES AVRNVRVNTI       180
     HPGPVNTRMM RDIEKDISPD NAQKAKKGFE AGVPFGRYAE AEEIADLVLF LASDESKYIT       240
     GSTYVIDGGM VAS                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page