(data stored in ACNUC7421 zone)

EMBL: CP002157.PE348

CP002157.PE348       Location/Qualifiers
FT   CDS             381146..381913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00425"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00085"
FT                   /db_xref="GOA:A4AV63"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV63"
FT                   /protein_id="EAR00085.1"
FT                   /translation="MAQLRIIEVTPKNVQEETLFCVKNIKNSGFNCKKSWFEKQYKRGL
FT                   HLKILKNGEDKMIGFIEYIPATNAWRPIEAEKFMFIHCIVVYSKKDRNKGYGSLLIHEV
FT                   EKDAKQEGLAGVCVMTSKGTWIASKEIFENSGYAQIDKKGRFELLTKQWDPKANSPKFI
FT                   DWNAQQSKHQGWNLIYANQCPWHEKSVAALLNTAMDYDIDLKVTELKTAREAQNAPSGY
FT                   GVFGLIHDGKLLEDHYLSATRFRNILKKELKIK"
     MAQLRIIEVT PKNVQEETLF CVKNIKNSGF NCKKSWFEKQ YKRGLHLKIL KNGEDKMIGF        60
     IEYIPATNAW RPIEAEKFMF IHCIVVYSKK DRNKGYGSLL IHEVEKDAKQ EGLAGVCVMT       120
     SKGTWIASKE IFENSGYAQI DKKGRFELLT KQWDPKANSP KFIDWNAQQS KHQGWNLIYA       180
     NQCPWHEKSV AALLNTAMDY DIDLKVTELK TAREAQNAPS GYGVFGLIHD GKLLEDHYLS       240
     ATRFRNILKK ELKIK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page