(data stored in ACNUC7421 zone)

EMBL: CP002157.PE35

CP002157.PE35        Location/Qualifiers
FT   CDS             48568..49749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16306"
FT                   /product="tryptophan synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16306"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00664"
FT                   /db_xref="GOA:A4AT94"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT94"
FT                   /protein_id="EAR00664.1"
FT                   /translation="MSYNANERGYYGEFGGAFIPEMLYPNTEKLRLNYIRIMNEPSFKK
FT                   EFDQLLKDYVGRPTPLYFAERLSKKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLG
FT                   KKRIIAETGAGQHGVATATVCALMGIECVVYMGEIDIARQAPNVARMKMLGAEVRPALS
FT                   GSRTLKDATNEAIRDWINNPVDTHYIIGSVVGPHPYPDMVARFQSIISEEIKWQLMEKE
FT                   GVENPNYVVACVGGGSNAAGAFYHFLDNPDVGIIAVEAAGKGIDSGESAATSALGEVGI
FT                   IHGSKTLLMQTKDGQITEPYSISAGLDYPGVGPMHAHLFKSGRGEFISITDDEAMKAGL
FT                   MICKLEGIIPAIESSHAFAILDDKKFKPEDVVVINLSGRGDKDLDTFIKYFDL"
     MSYNANERGY YGEFGGAFIP EMLYPNTEKL RLNYIRIMNE PSFKKEFDQL LKDYVGRPTP        60
     LYFAERLSKK YNTKIYLKRE DLCHTGAHKV NNTIGQILMA KKLGKKRIIA ETGAGQHGVA       120
     TATVCALMGI ECVVYMGEID IARQAPNVAR MKMLGAEVRP ALSGSRTLKD ATNEAIRDWI       180
     NNPVDTHYII GSVVGPHPYP DMVARFQSII SEEIKWQLME KEGVENPNYV VACVGGGSNA       240
     AGAFYHFLDN PDVGIIAVEA AGKGIDSGES AATSALGEVG IIHGSKTLLM QTKDGQITEP       300
     YSISAGLDYP GVGPMHAHLF KSGRGEFISI TDDEAMKAGL MICKLEGIIP AIESSHAFAI       360
     LDDKKFKPED VVVINLSGRG DKDLDTFIKY FDL                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page