(data stored in ACNUC7421 zone)

EMBL: CP002157.PE350

CP002157.PE350       Location/Qualifiers
FT   CDS             complement(382902..383549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00435"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00087"
FT                   /db_xref="GOA:A4AV65"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV65"
FT                   /protein_id="EAR00087.1"
FT                   /translation="MKITPKAPKPKILLLPLIGMLLFVILYILAALDYPGGSWLMPDQN
FT                   GFSFWNNYLCDLLDENAINGEFNPARYYAIASLTLLCFSLALLWYYLPNLFSGENFNQN
FT                   IMWLSGIVSLIVTAFLSSGTHDVTVRIAGVFGVIAFITCFMELYMEKYFKLVIYGGICL
FT                   LIFLTNYYIYETGIFLNALPVIQKITFISCIIWFVSLDLAFYKKLLTDHANK"
     MKITPKAPKP KILLLPLIGM LLFVILYILA ALDYPGGSWL MPDQNGFSFW NNYLCDLLDE        60
     NAINGEFNPA RYYAIASLTL LCFSLALLWY YLPNLFSGEN FNQNIMWLSG IVSLIVTAFL       120
     SSGTHDVTVR IAGVFGVIAF ITCFMELYME KYFKLVIYGG ICLLIFLTNY YIYETGIFLN       180
     ALPVIQKITF ISCIIWFVSL DLAFYKKLLT DHANK                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page