(data stored in ACNUC7421 zone)

EMBL: CP002157.PE351

CP002157.PE351       Location/Qualifiers
FT   CDS             complement(383576..384595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00440"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00088"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV66"
FT                   /protein_id="EAR00088.1"
FT                   /translation="MNYKYIFTSLTRISDLAEKEFQLKELPKKQWETGDYVVCKIVNAG
FT                   SETLKLELPNGRMRGIIGGETIVGALGDRFATLEATGTWRNVEDDLKMTVLTGAGLLGK
FT                   MTSKSVFIPQMMQVIYLGHAFRGAKKLTMESFVKPILTLPYKTPVVLFVGTSMSAGKTT
FT                   SARIVTNLFKQAGHKVVGAKLSGAGRYKDILAIKDVGADAIYDFVDVGLPSSICPQEKF
FT                   QKKLNQLLSRIELHKADIAIVEIGASPLEPYNGDVAIERLREHIKCIVLSASDPYAVYG
FT                   LMKAFDIVPNIVTGVASNTLGGKRLVEQLCKVKSLNLIDSTTTKELKRIITATTGFSL"
     MNYKYIFTSL TRISDLAEKE FQLKELPKKQ WETGDYVVCK IVNAGSETLK LELPNGRMRG        60
     IIGGETIVGA LGDRFATLEA TGTWRNVEDD LKMTVLTGAG LLGKMTSKSV FIPQMMQVIY       120
     LGHAFRGAKK LTMESFVKPI LTLPYKTPVV LFVGTSMSAG KTTSARIVTN LFKQAGHKVV       180
     GAKLSGAGRY KDILAIKDVG ADAIYDFVDV GLPSSICPQE KFQKKLNQLL SRIELHKADI       240
     AIVEIGASPL EPYNGDVAIE RLREHIKCIV LSASDPYAVY GLMKAFDIVP NIVTGVASNT       300
     LGGKRLVEQL CKVKSLNLID STTTKELKRI ITATTGFSL                              339
//

If you have problems or comments...

PBIL Back to PBIL home page