(data stored in ACNUC7421 zone)

EMBL: CP002157.PE359

CP002157.PE359       Location/Qualifiers
FT   CDS             390219..390455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00480"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00096"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV74"
FT                   /protein_id="EAR00096.1"
FT                   /translation="MKTTFEVQQAISPLDEKVILERFQFGMNIWNASVNPENRLISFEY
FT                   LNRNVLETVRRELGEMGYHVINNTHELDKNRKP"
     MKTTFEVQQA ISPLDEKVIL ERFQFGMNIW NASVNPENRL ISFEYLNRNV LETVRRELGE        60
     MGYHVINNTH ELDKNRKP                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page