(data stored in ACNUC7421 zone)

EMBL: CP002157.PE360

CP002157.PE360       Location/Qualifiers
FT   CDS             390477..391418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00485"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00097"
FT                   /db_xref="GOA:A4AV75"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV75"
FT                   /protein_id="EAR00097.1"
FT                   /translation="MSKRLRYTLTLLLLLLITITISKLLEIRREKNAIEPILDPVVIEK
FT                   TISKKYVTINDTIPIARYFDFMDSLVAVHESKTPYQLSEHILVKSNSWIIDTLAHTDYY
FT                   NMMQRDSFVYNQQRMIVFQPRDSIIIPDSLEACTISEHFDKIRIDINLPEYKLRVYKDS
FT                   LLLSTYPIRIGQNRIKYLKMGDRFTDLRTKQGNGMVIEYRRNPDFYNPVTGTQFFRTRR
FT                   DDGKTTLMPQIPWIVTEINGIRNGQLIHPTTNPKSLGKAYSNGCIGVKESDAWRIYYQC
FT                   PIGTEIVIRYNLKVIDDNGAEVLLKDIYQISP"
     MSKRLRYTLT LLLLLLITIT ISKLLEIRRE KNAIEPILDP VVIEKTISKK YVTINDTIPI        60
     ARYFDFMDSL VAVHESKTPY QLSEHILVKS NSWIIDTLAH TDYYNMMQRD SFVYNQQRMI       120
     VFQPRDSIII PDSLEACTIS EHFDKIRIDI NLPEYKLRVY KDSLLLSTYP IRIGQNRIKY       180
     LKMGDRFTDL RTKQGNGMVI EYRRNPDFYN PVTGTQFFRT RRDDGKTTLM PQIPWIVTEI       240
     NGIRNGQLIH PTTNPKSLGK AYSNGCIGVK ESDAWRIYYQ CPIGTEIVIR YNLKVIDDNG       300
     AEVLLKDIYQ ISP                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page