(data stored in ACNUC7421 zone)

EMBL: CP002157.PE362

CP002157.PE362       Location/Qualifiers
FT   CDS             complement(392629..393189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00495"
FT                   /product="thiol:disulfide interchange protein tlpA"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00495"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00099"
FT                   /db_xref="GOA:A4AV77"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV77"
FT                   /protein_id="EAR00099.1"
FT                   /translation="MMIISKKTLLNILLIAFVLAFFVTPLGHFGKVFLNQIFAGTPVII
FT                   EESSRQQLQSYNWKLKDPNWDYFNLDRSKGKVLFVNFWASWRLPCEAELKGIQKLYNDY
FT                   GDKVDFYIITNEEKAPVEEFMRLKKFDFPLTYLIIGEPAPFEILEPPASYIIDKNGFIV
FT                   VKEKDIASWDTGKIRELLDNLIK"
     MMIISKKTLL NILLIAFVLA FFVTPLGHFG KVFLNQIFAG TPVIIEESSR QQLQSYNWKL        60
     KDPNWDYFNL DRSKGKVLFV NFWASWRLPC EAELKGIQKL YNDYGDKVDF YIITNEEKAP       120
     VEEFMRLKKF DFPLTYLIIG EPAPFEILEP PASYIIDKNG FIVVKEKDIA SWDTGKIREL       180
     LDNLIK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page