(data stored in ACNUC7421 zone)

EMBL: CP002157.PE367

CP002157.PE367       Location/Qualifiers
FT   CDS             399069..399575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00520"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00104"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV82"
FT                   /protein_id="EAR00104.1"
FT                   /translation="MATANNIYYISIAKFEKMKYTTEILIDLPLNEFIKKLDNPDNMKH
FT                   WQKGLVKYNIISGAPGQEGGKMELRYQMGKRKIVMVETILKRNLPYEFHTTYDTKGVHN
FT                   VQKNYFKEISASQTKWISEAEFQFSGFMMKLMAFFMPGAFKKQSLKYLKDFKAFAEKGV
FT                   SVANS"
     MATANNIYYI SIAKFEKMKY TTEILIDLPL NEFIKKLDNP DNMKHWQKGL VKYNIISGAP        60
     GQEGGKMELR YQMGKRKIVM VETILKRNLP YEFHTTYDTK GVHNVQKNYF KEISASQTKW       120
     ISEAEFQFSG FMMKLMAFFM PGAFKKQSLK YLKDFKAFAE KGVSVANS                    168
//

If you have problems or comments...

PBIL Back to PBIL home page