(data stored in ACNUC7421 zone)

EMBL: CP002157.PE368

CP002157.PE368       Location/Qualifiers
FT   CDS             399594..399836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00525"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00105"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV83"
FT                   /protein_id="EAR00105.1"
FT                   /translation="MHRKIKLIWDFRGPAASKTAEHHEKHLKEYIAIEKLTLDITGFQD
FT                   INEMYSIAFMVVEEADMIAVRDALKPHRGEVYSDQ"
     MHRKIKLIWD FRGPAASKTA EHHEKHLKEY IAIEKLTLDI TGFQDINEMY SIAFMVVEEA        60
     DMIAVRDALK PHRGEVYSDQ                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page