(data stored in ACNUC7421 zone)

EMBL: CP002157.PE369

CP002157.PE369       Location/Qualifiers
FT   CDS             399854..400996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00530"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00106"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV84"
FT                   /protein_id="EAR00106.1"
FT                   /translation="MIKNQLTIFLVFCITISCAEKSVIKNPIEYALTSENINIKRVVDS
FT                   LEQYEVQIKLSQINRVKDSIIFKDYDFQVDESNYFYPASTVKFPIAVLAMEKLNKLDSI
FT                   DMNTRFYVEGDSIETTFANDVSKIFAVSDNLANNRLLEFIGQDAINKNLELKGITPVRI
FT                   AHRLSTENADEITTKPLIVYLNDSTTASINGTINTSAKPLEIKRTEKGIGYYAEDSLMT
FT                   GPFSFALKNYYPINAQHSVLKRMIFPEVFNENERFNLNDEQREFILEAMHTLPKNVGYD
FT                   PIEYYDSYVKFLMFGDSRENMPENIKVYNKVGYAYGTLTDCAYILDAKNNIEFMLTTTI
FT                   LVNKDGIFNDNVYEYEDVGIPFLAELGRVIYKYELKRKKK"
     MIKNQLTIFL VFCITISCAE KSVIKNPIEY ALTSENINIK RVVDSLEQYE VQIKLSQINR        60
     VKDSIIFKDY DFQVDESNYF YPASTVKFPI AVLAMEKLNK LDSIDMNTRF YVEGDSIETT       120
     FANDVSKIFA VSDNLANNRL LEFIGQDAIN KNLELKGITP VRIAHRLSTE NADEITTKPL       180
     IVYLNDSTTA SINGTINTSA KPLEIKRTEK GIGYYAEDSL MTGPFSFALK NYYPINAQHS       240
     VLKRMIFPEV FNENERFNLN DEQREFILEA MHTLPKNVGY DPIEYYDSYV KFLMFGDSRE       300
     NMPENIKVYN KVGYAYGTLT DCAYILDAKN NIEFMLTTTI LVNKDGIFND NVYEYEDVGI       360
     PFLAELGRVI YKYELKRKKK                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page