(data stored in ACNUC7421 zone)

EMBL: CP002157.PE371

CP002157.PE371       Location/Qualifiers
FT   CDS             401928..403325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00540"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00108"
FT                   /db_xref="GOA:A4AV86"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV86"
FT                   /protein_id="EAR00108.1"
FT                   /translation="MSLIIINLDKINIKDSILKLSIMTNKLFQGTNKMYSAIILAILFI
FT                   GMAGIPNASAFFQDEQEQEINFKQYKGEIRDADNKKPLVFATLTVEGTNISTISNTEGE
FT                   FALKVPKDMSEGNVLISFLGYKTKLLPLAQFKDGNNKIYMDISIVELSEVSLSIPTNAE
FT                   GLVRETLKKRGQNYFDDPTLMTAFYRETIKKRKRNVSLSEAVVNIYKTPYTSSRKDAVQ
FT                   LYKARKSTDYSKLDTIALKLQGGPFNALFVDIMKYPEYIFADNSLNKYDFSFDRSTKVK
FT                   DRQIFVVNFIQKPSVHEQLYKGKLYIDAENKILTSAIYALNITNKHEASKLFVRRKPRN
FT                   AKVWPNEVAYRVDYREKNGRWYYGYSNVLLEFKIDWDKKLFNSVYSMTCEMAVTDWEKN
FT                   LSNEMPKSKERIKTSIILGDEAIGFADPDFWGEYNIIEPEKSIESAIKKIQRQLKKSKT
FT                   RGGTSAP"
     MSLIIINLDK INIKDSILKL SIMTNKLFQG TNKMYSAIIL AILFIGMAGI PNASAFFQDE        60
     QEQEINFKQY KGEIRDADNK KPLVFATLTV EGTNISTISN TEGEFALKVP KDMSEGNVLI       120
     SFLGYKTKLL PLAQFKDGNN KIYMDISIVE LSEVSLSIPT NAEGLVRETL KKRGQNYFDD       180
     PTLMTAFYRE TIKKRKRNVS LSEAVVNIYK TPYTSSRKDA VQLYKARKST DYSKLDTIAL       240
     KLQGGPFNAL FVDIMKYPEY IFADNSLNKY DFSFDRSTKV KDRQIFVVNF IQKPSVHEQL       300
     YKGKLYIDAE NKILTSAIYA LNITNKHEAS KLFVRRKPRN AKVWPNEVAY RVDYREKNGR       360
     WYYGYSNVLL EFKIDWDKKL FNSVYSMTCE MAVTDWEKNL SNEMPKSKER IKTSIILGDE       420
     AIGFADPDFW GEYNIIEPEK SIESAIKKIQ RQLKKSKTRG GTSAP                       465
//

If you have problems or comments...

PBIL Back to PBIL home page