(data stored in ACNUC7421 zone)

EMBL: CP002157.PE374

CP002157.PE374       Location/Qualifiers
FT   CDS             406773..407615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00555"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00555"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00111"
FT                   /db_xref="GOA:A4AV89"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV89"
FT                   /protein_id="EAR00111.1"
FT                   /translation="MAKKKNTKPHNEMSFLDHLEELRWHLIRSVFVVVIIGCIAFVMRE
FT                   FIFDTILFGPKKMDFPTYRFFCKAATFLGFDSAFCADKLPFTIQSRLMAGQFSAHIWTS
FT                   IWAGFIIGFPYVLYEMWKFISPGLYEKERKNSRGFILIASFLFFLGVLFGYYVVAPLSI
FT                   NFLGTYQVSAEVTNEFDLASYVATVRSAVIACGVLFELPIIIFFLTKVGLITPEIMKKY
FT                   RKIALVIVLILSAVITPPDVASQIIVAVPVLILYQISIYISKMVLKREAKKEAKLKKG"
     MAKKKNTKPH NEMSFLDHLE ELRWHLIRSV FVVVIIGCIA FVMREFIFDT ILFGPKKMDF        60
     PTYRFFCKAA TFLGFDSAFC ADKLPFTIQS RLMAGQFSAH IWTSIWAGFI IGFPYVLYEM       120
     WKFISPGLYE KERKNSRGFI LIASFLFFLG VLFGYYVVAP LSINFLGTYQ VSAEVTNEFD       180
     LASYVATVRS AVIACGVLFE LPIIIFFLTK VGLITPEIMK KYRKIALVIV LILSAVITPP       240
     DVASQIIVAV PVLILYQISI YISKMVLKRE AKKEAKLKKG                             280
//

If you have problems or comments...

PBIL Back to PBIL home page