(data stored in ACNUC7421 zone)

EMBL: CP002157.PE377

CP002157.PE377       Location/Qualifiers
FT   CDS             409301..410491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00570"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00114"
FT                   /db_xref="GOA:A4AV92"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV92"
FT                   /protein_id="EAR00114.1"
FT                   /translation="MWLKKLFFFFTFLFSLAIYSQIPELSPLSKISVLTCGSGDQLYST
FT                   FGHSAFRVQDKAVGIDVVYNYGVFDFRSKNFYGKFAKGKLDYTLARQQYSNFIREYKYD
FT                   QRWVNEQQLELTQLERNELFKFLENNYLPENRAYQYDFFYNNCSTKIWDVLKNVFGNRL
FT                   SIDENYLQKQFTHRELIHQNMPTNSWSAFGIDLALGAVIDDMATPKEHMFLPSYIMQQL
FT                   NTSLLDSEAIAPQQIAIYKPTPIENTNNFFLTPLFWSLVLMTIVFVVTYFDFKKAKRSG
FT                   WLDFSLLLFTGVAGVIIFFLWFLTDHTATASNYNILWAFPLNLNLAFFVWRVKPFSKLI
FT                   EWYILILLFFLVVTAIIWLLGIQIFSPVIIPILLALVARYTFLYFSNRNQNSQKSK"
     MWLKKLFFFF TFLFSLAIYS QIPELSPLSK ISVLTCGSGD QLYSTFGHSA FRVQDKAVGI        60
     DVVYNYGVFD FRSKNFYGKF AKGKLDYTLA RQQYSNFIRE YKYDQRWVNE QQLELTQLER       120
     NELFKFLENN YLPENRAYQY DFFYNNCSTK IWDVLKNVFG NRLSIDENYL QKQFTHRELI       180
     HQNMPTNSWS AFGIDLALGA VIDDMATPKE HMFLPSYIMQ QLNTSLLDSE AIAPQQIAIY       240
     KPTPIENTNN FFLTPLFWSL VLMTIVFVVT YFDFKKAKRS GWLDFSLLLF TGVAGVIIFF       300
     LWFLTDHTAT ASNYNILWAF PLNLNLAFFV WRVKPFSKLI EWYILILLFF LVVTAIIWLL       360
     GIQIFSPVII PILLALVARY TFLYFSNRNQ NSQKSK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page