(data stored in ACNUC7421 zone)

EMBL: CP002157.PE379

CP002157.PE379       Location/Qualifiers
FT   CDS             412382..412885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV94"
FT                   /protein_id="EAR00116.1"
FT                   /translation="MLYKIFSYLKFIFTATNQHGVHSPFIYNFVTKCLYKKSKFKHPKT
FT                   FRVLLESCSYFNVKKISIIPKNMHVQSLIKNTYPQIDFNEQPYDIIYMDLPNTKMFNGI
FT                   LKNRLYHNNSMLLVKNIYQSKDSSQSWELIKSNVEITASIDMFHCGALFFRQEQTKEHF
FT                   KIRI"
     MLYKIFSYLK FIFTATNQHG VHSPFIYNFV TKCLYKKSKF KHPKTFRVLL ESCSYFNVKK        60
     ISIIPKNMHV QSLIKNTYPQ IDFNEQPYDI IYMDLPNTKM FNGILKNRLY HNNSMLLVKN       120
     IYQSKDSSQS WELIKSNVEI TASIDMFHCG ALFFRQEQTK EHFKIRI                     167
//

If you have problems or comments...

PBIL Back to PBIL home page