(data stored in ACNUC7421 zone)

EMBL: CP002157.PE380

CP002157.PE380       Location/Qualifiers
FT   CDS             412940..413089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00585"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00117"
FT                   /db_xref="GOA:A4AV95"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV95"
FT                   /protein_id="EAR00117.1"
FT                   /translation="MEYPIYTVLGVLFVIYLFITIYNRKKSKRRRSKKFMDGYERQDRK
FT                   SNNE"
     MEYPIYTVLG VLFVIYLFIT IYNRKKSKRR RSKKFMDGYE RQDRKSNNE                    49
//

If you have problems or comments...

PBIL Back to PBIL home page