(data stored in ACNUC7421 zone)

EMBL: CP002157.PE382

CP002157.PE382       Location/Qualifiers
FT   CDS             413798..414022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00595"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00119"
FT                   /db_xref="InterPro:IPR021527"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV97"
FT                   /protein_id="EAR00119.1"
FT                   /translation="MYWTLELASYLSDAPWPATKDELIDYCIRTGAPLEVVENLQAMEE
FT                   EGGEIYESIEEIWPDYPTEEDYLWNEDEY"
     MYWTLELASY LSDAPWPATK DELIDYCIRT GAPLEVVENL QAMEEEGGEI YESIEEIWPD        60
     YPTEEDYLWN EDEY                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page