(data stored in ACNUC7421 zone)

EMBL: CP002157.PE385

CP002157.PE385       Location/Qualifiers
FT   CDS             419365..420579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00610"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00122"
FT                   /db_xref="GOA:A4AVA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA0"
FT                   /protein_id="EAR00122.1"
FT                   /translation="MSETAINQERLNDKIKLVLKVNYFSSALALCFGIACYFLLGITEI
FT                   IPYAFIAFGIANLINTFLFQKHKSLTTTYNITSVLALISTLIITLYSGGISSPFIFILA
FT                   LIVFAGYVTTRKYGQIYLNLIFFLIILVYSQSLPEFSFTHNVIPSESLDVFGLCSVLFA
FT                   VYLLGHVFGKNLLRTHHALYRSKNQLQKRINEKETLLKEVHHRVKNNLQTVSSLLSLQT
FT                   RSIEDDKMKNIIKSSQNRVISMAMVHEMLYMRDDLSKIEYKTYVKELSEYLIRSLKGAE
FT                   NNITLNIDIADIKLGIDTAIPLGLLINEAITNALKYGIVDDNEGEINIAIKKEPNNEYV
FT                   LNIGDNGIGFDDTIDHKTTKSLGLKLIHNLARQLKGSISKDHSKKGTNYIVKFTEVGQE
FT                   FRSIV"
     MSETAINQER LNDKIKLVLK VNYFSSALAL CFGIACYFLL GITEIIPYAF IAFGIANLIN        60
     TFLFQKHKSL TTTYNITSVL ALISTLIITL YSGGISSPFI FILALIVFAG YVTTRKYGQI       120
     YLNLIFFLII LVYSQSLPEF SFTHNVIPSE SLDVFGLCSV LFAVYLLGHV FGKNLLRTHH       180
     ALYRSKNQLQ KRINEKETLL KEVHHRVKNN LQTVSSLLSL QTRSIEDDKM KNIIKSSQNR       240
     VISMAMVHEM LYMRDDLSKI EYKTYVKELS EYLIRSLKGA ENNITLNIDI ADIKLGIDTA       300
     IPLGLLINEA ITNALKYGIV DDNEGEINIA IKKEPNNEYV LNIGDNGIGF DDTIDHKTTK       360
     SLGLKLIHNL ARQLKGSISK DHSKKGTNYI VKFTEVGQEF RSIV                        404
//

If you have problems or comments...

PBIL Back to PBIL home page