(data stored in ACNUC7421 zone)

EMBL: CP002157.PE387

CP002157.PE387       Location/Qualifiers
FT   CDS             423283..424803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00620"
FT                   /product="Amidohydrolase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00124"
FT                   /db_xref="GOA:A4AVA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA2"
FT                   /protein_id="EAR00124.1"
FT                   /translation="MNITAQSAAGDGPHTQLIIRGVMLINGNGAPPQGPIDIVVENNII
FT                   KKIQVVGYPGVAIKDSSRPKLKAGGKELDCTGMYLLPGFVDMHGHIGGTSQGADSEYVF
FT                   RLWMSHGITTVREPSGRGVDYTLDLKRKSAKNEIVAPRILAYTGFGQGNGGPITTAEMA
FT                   REWVRDNAKKGADGIKFFGAEPEIMDAALRENKKLGLRSACHHAQLNVARWNVLHSARA
FT                   GLTSMEHWYGLPEALFEDRTIQNYPLDYNYNNEQHRFEEAGRLWKQAAKPYSEHWNAVM
FT                   DELLALDFTLDPTFNIYEASRDLQRARRAEWHEEYTLPSLWEFYQPSKISHGSYWHDWG
FT                   TEQEVAWKENYRLWMTFVNEYKNRGGRVTAGSDSGFIFQLYGFAYVRELELLREAGFHP
FT                   LEIIRSATLNGAEALGMGDKIGSVTVGKFADFVVVEENPLKNLKVLYGTGAVKLTEDNE
FT                   VVRVGGVKYTIKDGIVYDAKALLKEVKEMVDTEKKNKHYKILQPGIKE"
     MNITAQSAAG DGPHTQLIIR GVMLINGNGA PPQGPIDIVV ENNIIKKIQV VGYPGVAIKD        60
     SSRPKLKAGG KELDCTGMYL LPGFVDMHGH IGGTSQGADS EYVFRLWMSH GITTVREPSG       120
     RGVDYTLDLK RKSAKNEIVA PRILAYTGFG QGNGGPITTA EMAREWVRDN AKKGADGIKF       180
     FGAEPEIMDA ALRENKKLGL RSACHHAQLN VARWNVLHSA RAGLTSMEHW YGLPEALFED       240
     RTIQNYPLDY NYNNEQHRFE EAGRLWKQAA KPYSEHWNAV MDELLALDFT LDPTFNIYEA       300
     SRDLQRARRA EWHEEYTLPS LWEFYQPSKI SHGSYWHDWG TEQEVAWKEN YRLWMTFVNE       360
     YKNRGGRVTA GSDSGFIFQL YGFAYVRELE LLREAGFHPL EIIRSATLNG AEALGMGDKI       420
     GSVTVGKFAD FVVVEENPLK NLKVLYGTGA VKLTEDNEVV RVGGVKYTIK DGIVYDAKAL       480
     LKEVKEMVDT EKKNKHYKIL QPGIKE                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page