(data stored in ACNUC7421 zone)

EMBL: CP002157.PE388

CP002157.PE388       Location/Qualifiers
FT   CDS             complement(424879..424989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00625"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00125"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA3"
FT                   /protein_id="EAR00125.1"
FT                   /translation="MILFILLIPIALFIVNGIVFPKTKGFLQPIKVPSQR"
     MILFILLIPI ALFIVNGIVF PKTKGFLQPI KVPSQR                                  36
//

If you have problems or comments...

PBIL Back to PBIL home page