(data stored in ACNUC7421 zone)

EMBL: CP002157.PE389

CP002157.PE389       Location/Qualifiers
FT   CDS             complement(425039..425296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00630"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00126"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA4"
FT                   /protein_id="EAR00126.1"
FT                   /translation="MKAIFTLIFILFFGLTAFAQNTETNDTLEPIKMDVVLDSGVITIN
FT                   NTKEIKIGSEKSVARLYKFKNSRVKKALAFTTKKDRPKLT"
     MKAIFTLIFI LFFGLTAFAQ NTETNDTLEP IKMDVVLDSG VITINNTKEI KIGSEKSVAR        60
     LYKFKNSRVK KALAFTTKKD RPKLT                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page