(data stored in ACNUC7421 zone)

EMBL: CP002157.PE39

CP002157.PE39        Location/Qualifiers
FT   CDS             complement(52268..52876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16326"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00668"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4AT98"
FT                   /protein_id="EAR00668.1"
FT                   /translation="MFLNVFQKQDIEKVQEEITTVINPTKIITDLEKKLMFSETFENRV
FT                   ALADAYLKAKMFDEAEGHYRTSLQGTFENDYYVNTQLLETLYFSSQFEKVLSHVGSIKD
FT                   SPKFKKSRASFLYALALEKTGDIALAEEYLIKFDAPYSRYQERLELAKFYIRIDSIDKA
FT                   RALLKEIEEESVGMSKTSYKQNKILIKKAKDLLESGLGN"
     MFLNVFQKQD IEKVQEEITT VINPTKIITD LEKKLMFSET FENRVALADA YLKAKMFDEA        60
     EGHYRTSLQG TFENDYYVNT QLLETLYFSS QFEKVLSHVG SIKDSPKFKK SRASFLYALA       120
     LEKTGDIALA EEYLIKFDAP YSRYQERLEL AKFYIRIDSI DKARALLKEI EEESVGMSKT       180
     SYKQNKILIK KAKDLLESGL GN                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page