(data stored in ACNUC7421 zone)

EMBL: CP002157.PE397

CP002157.PE397       Location/Qualifiers
FT   CDS             430796..432181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00134"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB2"
FT                   /protein_id="EAR00134.1"
FT                   /translation="MKLPKIYRFNLLYLLIGFLLFSCSQTKKDNTPWVEIFDGETLNGW
FT                   TQKGGEANYTVREGSIVGSTIHDTPNSFMTSDKMYGDFILELEYLVDSTMNSGIQIRSN
FT                   SYPHYMHGRVHGYQIEIDPSDRAWSAGIYDEGRRGWLNNLIDNPDAQKGFKQNDWNHYR
FT                   IEAIGDTLKTWINGIPAAHLIDDKTASGFIGLQVHSIGKDKKEGTEIIWKNIKILTDSL
FT                   SKYSKTTPLEPIITTNKVAVDEIKNGWQMLWDGKTTNGWRGARLDEFPENGWEITNGIL
FT                   TVLPSGGEESAAGGDIVTKEVYGDFELKVDFKITEGANSGIKYYVDTDLNKGPGSSIGL
FT                   EYQILDDARHPDAKKGNHEGSRTVASLYDLIQAATDKPVNPIGEWNTAHIISKDNQVEH
FT                   RLNGMTVLKYERKSDSYKKLVSESKYVKWPNFGEVEKGHILLQDHGDRVSFKNIKIKPI
FT                   IKK"
     MKLPKIYRFN LLYLLIGFLL FSCSQTKKDN TPWVEIFDGE TLNGWTQKGG EANYTVREGS        60
     IVGSTIHDTP NSFMTSDKMY GDFILELEYL VDSTMNSGIQ IRSNSYPHYM HGRVHGYQIE       120
     IDPSDRAWSA GIYDEGRRGW LNNLIDNPDA QKGFKQNDWN HYRIEAIGDT LKTWINGIPA       180
     AHLIDDKTAS GFIGLQVHSI GKDKKEGTEI IWKNIKILTD SLSKYSKTTP LEPIITTNKV       240
     AVDEIKNGWQ MLWDGKTTNG WRGARLDEFP ENGWEITNGI LTVLPSGGEE SAAGGDIVTK       300
     EVYGDFELKV DFKITEGANS GIKYYVDTDL NKGPGSSIGL EYQILDDARH PDAKKGNHEG       360
     SRTVASLYDL IQAATDKPVN PIGEWNTAHI ISKDNQVEHR LNGMTVLKYE RKSDSYKKLV       420
     SESKYVKWPN FGEVEKGHIL LQDHGDRVSF KNIKIKPIIK K                           461
//

If you have problems or comments...

PBIL Back to PBIL home page