(data stored in ACNUC7421 zone)

EMBL: CP002157.PE401

CP002157.PE401       Location/Qualifiers
FT   CDS             complement(436259..436843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00690"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00138"
FT                   /db_xref="GOA:A4AVB6"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB6"
FT                   /protein_id="EAR00138.1"
FT                   /translation="MARDLRKLFEEDQKSEHFVMNEGHEKRFMDLLDKELPEKKKSTFF
FT                   MLKIAAAVLVLFSIGAAFYMNREEAGIKTTIVDKDPGIESKTGISLGDLSPDLRKVENY
FT                   YVANINLELSKLNVSGENKEMVDSYMERLTELDIEYRKLNEELNQVGPNDQTISALIKN
FT                   LQLRLQLLQKLKEKLNEVQSSKNEQYETNAV"
     MARDLRKLFE EDQKSEHFVM NEGHEKRFMD LLDKELPEKK KSTFFMLKIA AAVLVLFSIG        60
     AAFYMNREEA GIKTTIVDKD PGIESKTGIS LGDLSPDLRK VENYYVANIN LELSKLNVSG       120
     ENKEMVDSYM ERLTELDIEY RKLNEELNQV GPNDQTISAL IKNLQLRLQL LQKLKEKLNE       180
     VQSSKNEQYE TNAV                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page