(data stored in ACNUC7421 zone)

EMBL: CP002157.PE406

CP002157.PE406       Location/Qualifiers
FT   CDS             440268..440879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00715"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00715"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00143"
FT                   /db_xref="GOA:A4AVC1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC1"
FT                   /protein_id="EAR00143.1"
FT                   /translation="MFYNLFLPGGIGGDAYKGYLIKKNFEVDTKKVVSVLILDRLSGLL
FT                   LLFIYACILAILLDNTLLAKYELVIWVLGILSVVVFWFLIKRFFNYVLPVFWRSFLLSA
FT                   LVQLAQLICVYFILQSLSIQLDTIAYLFIFLLSSIVSVLPLTIGGIGSREVTFFYGATL
FT                   LALDENTSISISMVFFLITALVSFFGLIYHFKKVLLKTTD"
     MFYNLFLPGG IGGDAYKGYL IKKNFEVDTK KVVSVLILDR LSGLLLLFIY ACILAILLDN        60
     TLLAKYELVI WVLGILSVVV FWFLIKRFFN YVLPVFWRSF LLSALVQLAQ LICVYFILQS       120
     LSIQLDTIAY LFIFLLSSIV SVLPLTIGGI GSREVTFFYG ATLLALDENT SISISMVFFL       180
     ITALVSFFGL IYHFKKVLLK TTD                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page