(data stored in ACNUC7421 zone)

EMBL: CP002157.PE407

CP002157.PE407       Location/Qualifiers
FT   CDS             complement(440876..442534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00720"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00144"
FT                   /db_xref="GOA:A4AVC2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC2"
FT                   /protein_id="EAR00144.1"
FT                   /translation="MISNTRYWFLMAMIVLVYIAGMFVTLFENDSAQFAVMAMRMVQEN
FT                   DFLSLFKGPGEYLDKPHMHYWLAALSFKIFGLFEWAYRIPAILATLLGAYSCFGLGKLL
FT                   YNQNVGKLAALIFMTSQTIVLGVIDVRTDAVLTGFAVFSIWHLAVYIEKNSLKHMILGT
FT                   IGAGIAFSTKGQIALLVIGLPILCHLGYTRQWKMFLNWRVLVGLIVFALVITPMLYAYY
FT                   HQFDLHPEKIIRGKGNRSGIFFIFWEQSFERLSGEGVGKNSSDYFFFFHTFLWVFLPWT
FT                   VVGLLAYWNKVKNMIRTKFRFNSENEVLTLGGITLIFIIISFAQFKLPHYLNIVMPLFA
FT                   VLSASYLYKLYKEGDQPLKKVLLGFQYLVLAVIFIATVFICFFVFKADSYYNFIWKGVL
FT                   AVLIVYYCLKREDYYFRIITVGVMSSVLLNGVLNTHFYPTLLEYQAGSTMSKTIKEQNI
FT                   PVDNIYKISGNHTWGLDFYNQHPVKITSIEDLKQQQGLWVYANDKELISMKKEGLDWDK
FT                   QLSEKQFRITRLQAKFLDPSTRKKVLNKMHLIHIR"
     MISNTRYWFL MAMIVLVYIA GMFVTLFEND SAQFAVMAMR MVQENDFLSL FKGPGEYLDK        60
     PHMHYWLAAL SFKIFGLFEW AYRIPAILAT LLGAYSCFGL GKLLYNQNVG KLAALIFMTS       120
     QTIVLGVIDV RTDAVLTGFA VFSIWHLAVY IEKNSLKHMI LGTIGAGIAF STKGQIALLV       180
     IGLPILCHLG YTRQWKMFLN WRVLVGLIVF ALVITPMLYA YYHQFDLHPE KIIRGKGNRS       240
     GIFFIFWEQS FERLSGEGVG KNSSDYFFFF HTFLWVFLPW TVVGLLAYWN KVKNMIRTKF       300
     RFNSENEVLT LGGITLIFII ISFAQFKLPH YLNIVMPLFA VLSASYLYKL YKEGDQPLKK       360
     VLLGFQYLVL AVIFIATVFI CFFVFKADSY YNFIWKGVLA VLIVYYCLKR EDYYFRIITV       420
     GVMSSVLLNG VLNTHFYPTL LEYQAGSTMS KTIKEQNIPV DNIYKISGNH TWGLDFYNQH       480
     PVKITSIEDL KQQQGLWVYA NDKELISMKK EGLDWDKQLS EKQFRITRLQ AKFLDPSTRK       540
     KVLNKMHLIH IR                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page