(data stored in ACNUC7421 zone)

EMBL: CP002157.PE41

CP002157.PE41        Location/Qualifiers
FT   CDS             complement(55888..56547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16336"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00670"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATA0"
FT                   /protein_id="EAR00670.1"
FT                   /translation="MFLHSHPYEPFIFEEVTKLIVGTLPPPRFTTKELKKRDVDFSYGS
FT                   RDGQLWPILDCIFDLNLLFETSEEAIYQRKNFLRTRKIGVCDIVESAERLKVDASDLGM
FT                   RNIKLRNVLSYVEDLPNVKTLLFTGGNSKNGPEYFFRQLLKKHNISLDVINNDVPRIHQ
FT                   FELSDSSRVIRTVSLTAPSGAANRAVGSINEYKRLKAENPNFNTFDFRVLQYMSFF"
     MFLHSHPYEP FIFEEVTKLI VGTLPPPRFT TKELKKRDVD FSYGSRDGQL WPILDCIFDL        60
     NLLFETSEEA IYQRKNFLRT RKIGVCDIVE SAERLKVDAS DLGMRNIKLR NVLSYVEDLP       120
     NVKTLLFTGG NSKNGPEYFF RQLLKKHNIS LDVINNDVPR IHQFELSDSS RVIRTVSLTA       180
     PSGAANRAVG SINEYKRLKA ENPNFNTFDF RVLQYMSFF                              219
//

If you have problems or comments...

PBIL Back to PBIL home page