(data stored in ACNUC7421 zone)

EMBL: CP002157.PE417

CP002157.PE417       Location/Qualifiers
FT   CDS             complement(451097..451696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00770"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00154"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD2"
FT                   /protein_id="EAR00154.1"
FT                   /translation="MYMKGFLNYLVSAMALLVMTSCFFNNAKPAELFKKNSKECFISGD
FT                   ATWNFIDNEIVGIAKGASGFIMTKKSYKNFILELEFKPDSTVNSGIFIRCKNKELSMVD
FT                   CYENNIWDLHPNQENRTGAVVNRSKPLIYVNTLDKWNTYKIKIEKNHLQTWVNGELITD
FT                   LHDNDLSEGMIALQAAETGEIRFRNIKFQNLYSGTN"
     MYMKGFLNYL VSAMALLVMT SCFFNNAKPA ELFKKNSKEC FISGDATWNF IDNEIVGIAK        60
     GASGFIMTKK SYKNFILELE FKPDSTVNSG IFIRCKNKEL SMVDCYENNI WDLHPNQENR       120
     TGAVVNRSKP LIYVNTLDKW NTYKIKIEKN HLQTWVNGEL ITDLHDNDLS EGMIALQAAE       180
     TGEIRFRNIK FQNLYSGTN                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page