(data stored in ACNUC7421 zone)

EMBL: CP002157.PE419

CP002157.PE419       Location/Qualifiers
FT   CDS             complement(454026..454358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00780"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00156"
FT                   /db_xref="InterPro:IPR021274"
FT                   /db_xref="InterPro:IPR023154"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD4"
FT                   /protein_id="EAR00156.1"
FT                   /translation="MSDLAEKLAKLKETAEGQLKECGVSNVDQELLESLVNRLRTMVDN
FT                   KDATLVSGKDASELETVRRNFAEKKLGVTDKDKAMAAINKVAEKMSGIRMKSRPAFYYL
FT                   VQQELS"
     MSDLAEKLAK LKETAEGQLK ECGVSNVDQE LLESLVNRLR TMVDNKDATL VSGKDASELE        60
     TVRRNFAEKK LGVTDKDKAM AAINKVAEKM SGIRMKSRPA FYYLVQQELS                  110
//

If you have problems or comments...

PBIL Back to PBIL home page