(data stored in ACNUC7421 zone)

EMBL: CP002157.PE421

CP002157.PE421       Location/Qualifiers
FT   CDS             455893..456618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00790"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00790"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00158"
FT                   /db_xref="GOA:A4AVD6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD6"
FT                   /protein_id="EAR00158.1"
FT                   /translation="MNAFLFEFIGTAMLILIGNGVVANLVLKNTKGSDLGWVGISIAWG
FT                   IAVFCGVFVSADASGAHLNPAVTVGLATAGKFGWELVPGYILSQVLGAMMGNFLIWLTY
FT                   KKQYDSTEDQGSILATFSTSPAIRNPFWNFMSEVIGTFTLVFGIFFIASGSVGEEAISL
FT                   GSLDALPVALLVIGIGFGLGGATGYAINPARDFGPRLMHALLPIKNKGTNDWGYAWVPI
FT                   LGPLTGGALAAFVYCLIGI"
     MNAFLFEFIG TAMLILIGNG VVANLVLKNT KGSDLGWVGI SIAWGIAVFC GVFVSADASG        60
     AHLNPAVTVG LATAGKFGWE LVPGYILSQV LGAMMGNFLI WLTYKKQYDS TEDQGSILAT       120
     FSTSPAIRNP FWNFMSEVIG TFTLVFGIFF IASGSVGEEA ISLGSLDALP VALLVIGIGF       180
     GLGGATGYAI NPARDFGPRL MHALLPIKNK GTNDWGYAWV PILGPLTGGA LAAFVYCLIG       240
     I                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page