(data stored in ACNUC7421 zone)

EMBL: CP002157.PE423

CP002157.PE423       Location/Qualifiers
FT   CDS             457494..458156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00800"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00800"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00160"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVD8"
FT                   /protein_id="EAR00160.1"
FT                   /translation="MKLTGAYYSILFLFITCFYGQAQKQNRFQGEVEAIQKKYDTLWNP
FT                   SKETIVFTGSSSIRLWKELNDLFPDHQIVNTGFGASLSTDLLHYCKELVINFNPYRVFI
FT                   YEGDNDLASKRKPKEILTTTKEIVSNIWMNNNKTQIILISAKPSITRWSLKRKYKRLNR
FT                   KFKRLAKKEELIQFVDVWSPMLEGKKINQELFLEDGLHMNARGYEIWYPLIKPFVLN"
     MKLTGAYYSI LFLFITCFYG QAQKQNRFQG EVEAIQKKYD TLWNPSKETI VFTGSSSIRL        60
     WKELNDLFPD HQIVNTGFGA SLSTDLLHYC KELVINFNPY RVFIYEGDND LASKRKPKEI       120
     LTTTKEIVSN IWMNNNKTQI ILISAKPSIT RWSLKRKYKR LNRKFKRLAK KEELIQFVDV       180
     WSPMLEGKKI NQELFLEDGL HMNARGYEIW YPLIKPFVLN                             220
//

If you have problems or comments...

PBIL Back to PBIL home page