(data stored in ACNUC7421 zone)

EMBL: CP002157.PE426

CP002157.PE426       Location/Qualifiers
FT   CDS             complement(461417..461836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00815"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00163"
FT                   /db_xref="InterPro:IPR041218"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE1"
FT                   /protein_id="EAR00163.1"
FT                   /translation="MSLEKIMSIGGKPGLYQLLTQTRSGFVAESLLDKKRITISAQSNV
FT                   SVLSEIAIYTLEEEIPLGEVFQKIQVKEKGGKTSIGHKDDKLKLEEYFFEVLPNYDEDR
FT                   VYASDIKKVIQWYNLLHDQGITEFVKDSEDSQEEE"
     MSLEKIMSIG GKPGLYQLLT QTRSGFVAES LLDKKRITIS AQSNVSVLSE IAIYTLEEEI        60
     PLGEVFQKIQ VKEKGGKTSI GHKDDKLKLE EYFFEVLPNY DEDRVYASDI KKVIQWYNLL       120
     HDQGITEFVK DSEDSQEEE                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page