(data stored in ACNUC7421 zone)

EMBL: CP002157.PE427

CP002157.PE427       Location/Qualifiers
FT   CDS             complement(461892..462482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00820"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00820"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00164"
FT                   /db_xref="GOA:A4AVE2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE2"
FT                   /protein_id="EAR00164.1"
FT                   /translation="MVLPIVAYGDPVLRKVGKEIEKNLPKLDELIENMWETMYNASGVG
FT                   LAAPQIGLPVRLFLVDATPFAEDDELSEKERKDLDGFKKVFINAKMQEETGEDWVFNEG
FT                   CLSIPEIREDVTRKDTITITYFDENFKKQTENFDGILARIIQHEYDHIEGILFTDKLSS
FT                   LKKRLLKGRLANISKGKINADYRMRFPNMKKAR"
     MVLPIVAYGD PVLRKVGKEI EKNLPKLDEL IENMWETMYN ASGVGLAAPQ IGLPVRLFLV        60
     DATPFAEDDE LSEKERKDLD GFKKVFINAK MQEETGEDWV FNEGCLSIPE IREDVTRKDT       120
     ITITYFDENF KKQTENFDGI LARIIQHEYD HIEGILFTDK LSSLKKRLLK GRLANISKGK       180
     INADYRMRFP NMKKAR                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page