(data stored in ACNUC7421 zone)

EMBL: CP002157.PE433

CP002157.PE433       Location/Qualifiers
FT   CDS             466303..466986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00850"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00170"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE8"
FT                   /protein_id="EAR00170.1"
FT                   /translation="MKIVILAAGIGSRLGNPFPKPLTPLNNGKSIMGMQISNLTTHFNV
FT                   DDISIVVGFKKDLIMERFPEVTYIYNPFFDRTNTSKSLLQALKKNKDKSVLWLNGDVVF
FT                   DSKLLDELKPYLNNDQSFVAVNTSKVAEEEVKYTLKDNYIHELSKTVKNGLGEAVGINF
FT                   IASKDIQSFIDCLEECDDNDYFERGLELAIEKDNIQITAVDISAFDCMEVDFKEDLENA
FT                   NNLFR"
     MKIVILAAGI GSRLGNPFPK PLTPLNNGKS IMGMQISNLT THFNVDDISI VVGFKKDLIM        60
     ERFPEVTYIY NPFFDRTNTS KSLLQALKKN KDKSVLWLNG DVVFDSKLLD ELKPYLNNDQ       120
     SFVAVNTSKV AEEEVKYTLK DNYIHELSKT VKNGLGEAVG INFIASKDIQ SFIDCLEECD       180
     DNDYFERGLE LAIEKDNIQI TAVDISAFDC MEVDFKEDLE NANNLFR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page