(data stored in ACNUC7421 zone)

EMBL: CP002157.PE435

CP002157.PE435       Location/Qualifiers
FT   CDS             468818..469387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00172"
FT                   /db_xref="GOA:A4AVF0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF0"
FT                   /protein_id="EAR00172.1"
FT                   /translation="MSDFTAEINSCIKVLSEGGLILYPTDTVWGIGCDATKEEAVQKVY
FT                   ALKQREDSKALISLVANDAMLERHVEQVPEVAYEILDLATKPTTIIYDNPKGLAPNVIA
FT                   QDNTMAIRVASDKFCQYLINKFRKPIISTSANVTGQSTPKSFSEISEPILKGVDYIVNL
FT                   EHDKKNESASSIIKLSNDGTVKVIRQ"
     MSDFTAEINS CIKVLSEGGL ILYPTDTVWG IGCDATKEEA VQKVYALKQR EDSKALISLV        60
     ANDAMLERHV EQVPEVAYEI LDLATKPTTI IYDNPKGLAP NVIAQDNTMA IRVASDKFCQ       120
     YLINKFRKPI ISTSANVTGQ STPKSFSEIS EPILKGVDYI VNLEHDKKNE SASSIIKLSN       180
     DGTVKVIRQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page