(data stored in ACNUC7421 zone)

EMBL: CP002157.PE438

CP002157.PE438       Location/Qualifiers
FT   CDS             471885..472382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00875"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00875"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00175"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF3"
FT                   /protein_id="EAR00175.1"
FT                   /translation="MIYKIRIILDAKEDIFRDMEIEASYSMEEFHNAIAQSFGFLGNEM
FT                   ASFYTCDENWKQDEEIALFDMSENGSDVRLMNETFLEDVITEKSPKMIYVYDFLNMWTF
FT                   FVELADIDDEEPGKSYPNILFSFGELPEAPPEKKFEADEPTMDFDDTFDNYDDLDFDEN
FT                   WN"
     MIYKIRIILD AKEDIFRDME IEASYSMEEF HNAIAQSFGF LGNEMASFYT CDENWKQDEE        60
     IALFDMSENG SDVRLMNETF LEDVITEKSP KMIYVYDFLN MWTFFVELAD IDDEEPGKSY       120
     PNILFSFGEL PEAPPEKKFE ADEPTMDFDD TFDNYDDLDF DENWN                       165
//

If you have problems or comments...

PBIL Back to PBIL home page