(data stored in ACNUC7421 zone)

EMBL: CP002157.PE439

CP002157.PE439       Location/Qualifiers
FT   CDS             472455..473513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00880"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00176"
FT                   /db_xref="GOA:A4AVF4"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF4"
FT                   /protein_id="EAR00176.1"
FT                   /translation="MINLYPTHIDSISLHRVGNKNKNEGVFLSEEPVNLNDETTGLLKE
FT                   YFFRPFREKEENYFKLSNEVDVEFNEIYKIASEVFANPSSAHENSIKIAKHLFEQSNHP
FT                   HIKSGEVYVTYLTGLLLDNEKVDALGIFKSELKHDFLQFEENGNNLDIVVQHGININKL
FT                   DKGCLIFNKNKEEGYKVLSVDSNRYDAKYWLENFLGVDALADENFYTKNYLKFCQNFAK
FT                   DVVLPAEDKQQEVLFMNKAVNHFAKNDAFEESNFLNEVMENPELIPEFKHYKVEKGPKY
FT                   SIEDVSNFDIANKAVSDARKKIKNVISLDTNIQIKMDFINPESAEKFVEKGWDEEKQMY
FT                   YYLVYFNKEQKS"
     MINLYPTHID SISLHRVGNK NKNEGVFLSE EPVNLNDETT GLLKEYFFRP FREKEENYFK        60
     LSNEVDVEFN EIYKIASEVF ANPSSAHENS IKIAKHLFEQ SNHPHIKSGE VYVTYLTGLL       120
     LDNEKVDALG IFKSELKHDF LQFEENGNNL DIVVQHGINI NKLDKGCLIF NKNKEEGYKV       180
     LSVDSNRYDA KYWLENFLGV DALADENFYT KNYLKFCQNF AKDVVLPAED KQQEVLFMNK       240
     AVNHFAKNDA FEESNFLNEV MENPELIPEF KHYKVEKGPK YSIEDVSNFD IANKAVSDAR       300
     KKIKNVISLD TNIQIKMDFI NPESAEKFVE KGWDEEKQMY YYLVYFNKEQ KS               352
//

If you have problems or comments...

PBIL Back to PBIL home page